Why Say it Three Times?

(1) Herr Tober, der Tober tobt.

(2) Mr. Rager, the rager rages.

(3) mainfestations through first name

(4) mainfestations through a middle name

(5) mainfestations through last or family name

(6) what esle?


That’s just what Computer Detectives was waiting for.
Write to computerdetectives2020@gmail.com.
We observe errors in Think Tank Technologies.
©Computer Detectives 2021

“Something”

(1) Something went wrong.

(2) repetitive

(3) artificial world

(4) anthropology

(5) etwas

(6) somatology

(7) apology

(8) apo

(9) wax

(10) wax-uun

(11) waxworks

(12) Apophyse

(13) what else?


That’s just what Computer Detectives was waiting for.
Write to computerdetectives2020@gmail.com.
We observe errors in Think Tank Technologies.
©Computer Detectives 2021

Bad Business

(1) The Wuhan Virus is bad business.

(2) Politicians are facilitators of bad business.

(3) Why is there no antibody treatment?

(4) The same lunatics every day!

(5) How to explain it to the fucking stupid: imagine the Wuhan Virus is a chicken and a human being is a truck. All that politicians in Germany are doing is trying to solve a logistical problem by telling the truck where to drive and where to drive not. That’s why they are fucking stupid. The virus was meant to happen, because it was not prevented. It is bad enough that governments try to gaslight their people, the people should not spent their engery and power to have fucking-stupid governments gaslight themselves. People decide what is business and what’s not! And it’s not driving around a truck with chickens, it’s everything else!

The truck that fell over today.

(6)   What is the Wuhan Virus strategy? A complacency test? How much senseless lock down strategies do people swallow before they object? Gaslighting people through fear? Fear from what a killer virus or a gaslighting government? It is more than clear that the Wuhan Virus strategies have nothing to do with the objective available possibilities to conquer it! Do you hear anywhere about antibody strategy? No! It’s all about money making from a vaccine – bad business and bullshitting politicians gaining a buck! The healthcare industry is so industrialized, that alternative approaches are not even financeable. That’s not free enterprise, that’s stupid gaslighting strategies to the point of provoking a revolution. I would kick butt, but I am afraid my feet get stuck and I have to run around with those ugly shoes!

(7) headlines

(8) the fucking-stupid: allow access to restaurants and cinemas if you are vaccinated. Instead of “allow access to cinemas and restaurants if you are immune”!

(9) Badezimmer Geschäfte

(10) Politicians that sell the Wuhan Virus vaccination with the lift of restrictions: you do not even know the basics about immunity that are tought in middle School. You are part of the bad business scam of a designed virus: to control and earn through fear and death, which is a war strategy. The fucking-stupid citzens that voted for you deserve you! Obviuosly not the middle schoolers and above.

(11) Bad Planer, OBI


“Angela Merkel” – how are you?

“Am I scared?” – I hear you, no I am not scared at all! Are you?

“Jens Spahn” – how are you? What are you doing connecting in my bathroom bad business?

“Peter Altmaier” – how are you?

“Kim Jong-un” – how is North Korea?

“Angela Merkel” – how are you again?

“dummes Zeug” – I hear you, identify sender, he is not a thinker! answer “stupid sheep!”


That’s just what Computer Detectives was waiting for.
Write to computerdetectives2020@gmail.com.
We observe errors in Think Tank Technologies.
©Computer Detectives 2021

Cloud Management

(1) the milk cloud in my coffee

(2) The steam cloud vaping from my hot coffee

(3) the steam cloud vaping from my hot tea

(4) the milk run

(5) “condense” – the old groomed guy at the train station platform in Germany

(6) https://www.youtube.com/watch?v=cleCtBP0o5Y

(7) dreams

(8) the importance of black coffee

(9) Jennifer Morgan, how are you?

(10) foam

(11) NLP

(12) OCR

(13) condensation evaporation from ashtrays

(14) condensation evaporation from coffee mugs

(15) what else?


That’s just what Computer Detectives was waiting for.
Write to computerdetectives2020@gmail.com.
We observe errors in Think Tank Technologies.
©Computer Detectives 2021

Das totalitäre Rechtsverständnis von ARD, ZDF Deutschlandradio Beitragsservice

In the Year 2017 ARD, ZDF, Deutschlandradio Beitragsservice charged €400,- fee for a three month rental in Hamburg. I ask periodically to clear the mismanagement of that account. It has not happened until today, the year is 2021 now! My account for Hamburg still shows a €400,- unpaid balance for a three month rental.
Because of this uncleared account in Hamburg I refuse to pay further fees.
Instead of clearing the account the service charges late fees? For what ? For their untimely response? The gaslighting or electrolyting effect of German radio waves have not changed since the mass manipulation 70 years ago. An objectively unjust customer situation is forced down the customers throat with unfair penalty payments. Criminal mass manipulation tactics in Germany! Why do we pay for consumer protection? Germany is not a free country, it looks more like a totalitarian radio wave controlled gaslighting state.


“Jorge Mario Bergoglio” – Pope Francis how are you? No I am watching a movie, thanks for asking! Yes, there are many movies.

“1601”


That’s just what Computer Detectives was waiting for.
Write to computerdetectives2020@gmail.com.
We observe errors in Think Tank Technologies.
©Computer Detectives 2021

ESA

(1) ESA Mateo Sat

(2) San Mateo California

(3) Walter Matthau

(4) European Space Policy

(5) ESP

(6) Extra Sensory Perception

(7) European Space Agency

(8) satt sein

(9) to be full

(10) hungry

(11) Hungarian

(12) sat

(13) satellite

(14) food fight

(15) sosondowah ankyrin

(16) SOS on dowah

(17) https://www.youtube.com/watch?v=43vOAw2sAFU

(18) Bordetella pertussis

(19) stupid search programs produce stupid results!

(20) NSA

(21) Norwegian Space Agency (NOSA)

(22) what else?


“stay positive” – thanks for the good wishes!

“Angela Merkel” – not you again! how are you?

“incompetent” – I hear you! are you talking about yourself? Well we don’t listen to the incompetent why are they connected?

“Tedros Adhanom Ghebreyesus” – criminals in office. You get what you deserve!

“Wladimir Wladimirowitsch Putin” – how are you?

“Herzverfettung” – I hear you, my bathroom is talking to me.

“Rachel Meghan Markle” – how are you?

“Andrew Albert Christian Edward Mountbatten-Windsor”- how are you?

Herta Z. – why do you connect?


That’s just what Computer Detectives was waiting for.
Write to computerdetectives2020@gmail.com.
We observe errors in Think Tank Technologies.
©Computer Detectives 2021

Gaslight (1944)

(1) to gaslight

(2) to electrolyte

(3) Elektrolytdatenbank Regensburg

(4) ELDAR

(5) DECHEMA

(6) Deutsche Gesellschaft für chemisches Apparatewesen

(7) old

(8) elder

(9) eldest

(10) old and ugly

(11) Suzanne Vega – Luka

(12) the fucking stupid? I hear you! Right, they are a part of all but we don’t work with them. What else do we do with them?

(13) APTKVTFGDDTVIEVQGYKSVNITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSE LLTPLGIDLDEWSMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGK PLEFGATSAALQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVVQTIEVNSF SGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLK VGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLRVCVDT VRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVEQKIAEIPKEEVKPFITESKPSVEQRKQDDKKIKACVEE VTTTLEETKFLTENLLLYIDINGNLHPDSATLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGG TTEMLAKALRKVPTDNYITTYPGQGLNGYTVEEAKTVLKKCKSAFYILPSIISNEKQEILGTVSWNLREM LAHAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTTVASLINTLNDLNETLVTM PLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSSKTPEEHFIETISLAGSYKDWSYSG QSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVITFDNLKTLLSLREVRTIKVFTTVDNINLHTQVVDMSM TYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKY PQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDV RETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLV QQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFY KENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDLVPNQPYPNASFDNFKFVCDNIKFA DDLNQLTGYKKPASRELKVTFFPDLNGDVVAIDYKHYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTW CIRCLWSTKPVETSNSFDVLKSEDAQGMDNLACEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGDIILK PANNSLKITEEVGHTDLMAAYVDNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPWDTIANYAKPFLNK VVSTTTNIVTRCLNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFNYL KSPNFSKLINIIIWFLLLSVCLGSLIYSTAALGVLMSNLGMPSYCTGYREGYLNSTNVTIATYCTGSIPC SVCLSGLDSLDTYPSLETIQITISSFKWDLTAFGLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHF ISNSWLMWLIINLVQMAPISAMVRMYIFFASFYYVWKSYVHVVDGCNSSTCMMCYKRNRATRVECTTIVN GVRRSFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKN GSIHLYFDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQP ILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAAR QGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHN IALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALKGG

(14) Is it a year?

(15) What year is it?

(16) It’s not a year – I hear you!

(17) “Ballesteros and Weinstein nomenclature”

(18) SAAR

(19) VIEW

(20) FELD

(21) SAY

(22) SAAL

(23) DID

(24) ATALL

(25) SAPPA

(26) CASE

(27) NY

(28) HITS

(29) ALL

(30) AID

(31) CIRCL

(32) LACE

(33) SEE

(34) PAN

(35) KITE

(36) TTT

(37) III

(38) AAL

(39) EVA

(40) RAN

(41) PIN

(42) The Wuhan Virus is telling a story and nobody is listening.

(43) what else?


“Angel Merkel” – how are you? how are your electrolytes today?

“Frank-Walter Steinmeier” – how are you today?

“Bolton”

“Ursula von der Leyen”

“Andreas” – growth hormones

“stressor” – soso you reacted!

“Siegfried” – what did you do with my phone!??

Now its really getting interesting: B. cleaned my air condition system in my Daimler Benz car , as soon as I left the house today A. St. called, he works with Telekom, after that I cannot find my phone anymore, this was clearly programming, most likely there was a chemical involved. The Nazis still have the same old methods: gas in a car attacks.

They are getting nervous, they start to attack!!!

Okay control team, thanks for your support!

So ist is a control structure for the human genome? Yes all this splicing going on.

the story.


“Kim Jong-un” – how are you?

“Norbert Otto Pich” – how are you?

“Angela Merkel” – how are you?


That’s just what Computer Detectives was waiting for.
Write to computerdetectives2020@gmail.com.
We observe errors in Think Tank Technologies.
©Computer Detectives 2021